DPCstruct | MC23532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 91 ± 20 aa |
| Standard deviation of domain lengths | 20.19 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 90.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7FC82 | 129-205 | DAIAEFFSSGSCAPGANNTMYNAQKHYVDRLCSLCIGEGENKCLRGGAEPFYSYTGAFRCLVHGGGDVAFVKHTTVP |
| A0A7R9QF97 | 19-103 | TQNCNRAEEMSQFFMGSCVPGAADARINSNGSGVDSLCSQCIGDQNGSHICEISGAERYSGEEGAFRCLVEGRGDVAFVSYKTAL |
| Q64599 | 11-78 | None |
| A0A423TE04 | 492-575 | None |
| A0A7N4PCF4 | 542-621 | None |
| A0A7R9P052 | 614-718 | None |
| A0A1A9XGS3 | 545-621 | None |
| A0A2B4SL84 | 110-190 | None |
| A0A2G8LE34 | 261-339 | None |
| A0A3Q2CXP8 | 124-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.