DPCstruct | MC23531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 204 ± 18 aa |
| Standard deviation of domain lengths | 17.60 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7EI06 | 1-226 | MDMGNDDTDNLGGAFRQGFLCPFCMQDLGDLVTLHVHVEKHHPKSAPADYSLDHFKGIFDKAKQKISHIDAFFLIGDANSSNGGAAA… |
| A0A7J8HUE8 | 1-199 | MASLDDPGEVREGFLCPLCLKDLQSFYQLHSHYEEEHSGEDRDVKGQIKSLVQKAKKAKNRLLKRDDDRGESGTQGYESFSYGGVDP… |
| A0A5B7DBR7 | 1-208 | None |
| A0A0N4W1I5 | 1-176 | None |
| H3ALD8 | 1-215 | None |
| A0A0C2IK14 | 2-173 | None |
| A0A819ZKY7 | 36-232 | None |
| A0A016S8E8 | 1-225 | None |
| A0A0L0C0S0 | 6-207 | None |
| A0A834JK83 | 408-599 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.