DPCstruct | MC2353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 109 ± 12 aa |
| Standard deviation of domain lengths | 12.05 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 35.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A419G287 | 138-248 | FSLPTELSQMVALRTQQILAYETGVALTADPLGGSYYLEYLTNIIEEAAAGILKEIKDMGGALEAIKSGWMEREMEKGALAYQKEVE… |
| A0A7J7AZN2 | 71-172 | DTPMMLDFLTAEEEETKICKTVDPWAGSYYVESLTAEIAEKAWKLIEEVEELGGMTKAIEAGIPKLRIEEAAARKQARIDSGQDIIV… |
| A0A381GFL2 | 11-112 | None |
| A0A7J2VXL2 | 2-97 | None |
| A0A376UFI3 | 94-203 | None |
| A0A2W4YZ63 | 1-132 | None |
| A0A2T2XD31 | 36-147 | None |
| A0A800DGW7 | 89-211 | None |
| K2A2A7 | 5-114 | None |
| A0A7Y2XUQ3 | 3-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.