DPCstruct | MC23528
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 210 ± 30 aa |
| Standard deviation of domain lengths | 30.30 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06889 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2S9A8 | 160-385 | AELAVSTRKPKPLSDSQLWALAVPAILTEFNRARHDLLGSEVTTPESIQSWKEGLKDWWSVTDRESLLETLDWLLEGGHRAGFNKLR… |
| Q1QY12 | 163-367 | PPWPSGSAGVWRLRAAFSPVLSATCEPSRDWPDVHRWLSEVWSIDDRDELIRLLLWLGGQGHRYTWDLDAQRLTVQGETARRRWQAS… |
| A0A3A9A874 | 44-246 | None |
| A0A379FGX0 | 15-221 | None |
| A0A1I1HD65 | 28-233 | None |
| A0A1G6CRL4 | 582-823 | None |
| A0A7U8X691 | 58-285 | None |
| A0A0X2NPD4 | 1-190 | None |
| G9YBT5 | 213-442 | None |
| A0A395V803 | 408-633 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.