DPCstruct | MC23527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 311 ± 49 aa |
| Standard deviation of domain lengths | 48.96 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09937 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150TJQ8 | 4-281 | QNLTPFLCGIKRVFRSPPRPEMSIVVRGSFVLRPGEALAPIEDPAEQASLTAEVFREDDEERRGECLYGGDFADVKRNAEVLLKARC… |
| Q2S6Q4 | 3-336 | QPNIVNHTPFVVEPLFFYDERNVPIVTVAVKASCDIVGTHHLRFSEQQAPLCLAGEYWGAPETASYKYEPEAVPLKLTTDVVLVGHA… |
| A0A2S9XK27 | 2-284 | None |
| A0A1M7PAR0 | 61-315 | None |
| A0A832EX85 | 7-283 | None |
| A0A836R904 | 2-231 | None |
| A0A150PE96 | 9-301 | None |
| A0A653X8S1 | 1-286 | None |
| A0A7C5NC19 | 4-389 | None |
| A0A521U9I5 | 221-531 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.