DPCstruct | MC23521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 200 ± 22 aa |
| Standard deviation of domain lengths | 21.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8LIA3 | 6-166 | VLSPTPKELAAATQEARETSFGTRRSLNPPPPPPGTVRVHFYSHMYKVIRGSDPDIWADVVLERNGDLDVSKLCKMWGLDHCLAIDP… |
| A0A5E3WLX6 | 1-214 | MSLVCSSPGESSLLETLHSVLDDVQDIFDYTTLYEPESRARELFCALGLRFLNMPVRRPLDKCHARPPPGCVRLRLFSAERRRAGFA… |
| A0A4S4LSB9 | 4-202 | None |
| S7Q746 | 3-181 | None |
| A0A4R0RLW2 | 209-416 | None |
| A0A0C3SAA5 | 2-223 | None |
| A0A5C3QBA9 | 7-194 | None |
| A0A2H3BEP0 | 1-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.