DPCstruct | MC2352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 464 |
|---|---|
| Mean domain length (aa) | 130 ± 26 aa |
| Standard deviation of domain lengths | 25.97 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.06 |
| Pfam Score | 95.76 |
| Assigned Pfam label(s) | CL0264- CL0063- CL0080- PF19648- CL0292 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N4VU66 | 155-300 | KPDFAGGKLRCLCKTRPVEVTLGSNVAHNHACGCSKCWKPPGALFSVVGVVPREHVSVTANADKLRVVDDAAVILRNACRECGAHLF… |
| A0A7J7AX02 | 246-363 | AAGSCLCGGIHYEVHGEIGPVIQCHCKRCRKANGTAFATNAPIQKADFKIVKGESLLKQFASTETTTRCFCQECGSPIISIKAEAPE… |
| A0A194V2T5 | 2-122 | None |
| A0A2U8G815 | 1-91 | None |
| A0A1J9S403 | 9-138 | None |
| A0A1D3DE17 | 2-118 | None |
| A0A318YN56 | 41-178 | None |
| A0A496Q330 | 15-122 | None |
| A0A535A059 | 210-358 | None |
| A0A4S2MZ63 | 54-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.