DPCstruct | MC23512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 91 ± 8 aa |
| Standard deviation of domain lengths | 8.31 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661PUD5 | 66-155 | EAANQPPVSILADVLANDIEQIPQRFILAIDDYHLIENKSVHDLLSQLLKNPLSKLHLVIISPRAPFLPLTLLRANNDINEIRANEL… |
| A0A5C2ENS8 | 45-127 | PRETAMLLIRALRTVPRRISVIVDDYDRLGSSLVDDVVLRLIEHSGGRLHLLLATRRVPNLPLARLDLHAQLSRIGSAHLALD |
| A0A7H4NVC1 | 1-108 | None |
| A0A7V0Z510 | 1-86 | None |
| A0A2N2DBJ0 | 36-124 | None |
| X8F5U6 | 46-144 | None |
| A0A418T932 | 1-94 | None |
| A0A0M2VPD5 | 114-203 | None |
| A0A7W1R8H4 | 20-110 | None |
| A0A4P6JPN0 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.