DPCstruct | MC2351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 123 |
|---|---|
| Mean domain length (aa) | 139 ± 20 aa |
| Standard deviation of domain lengths | 19.67 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379VTI3 | 18-167 | ELAEQNKIAAYNYPQGVLTQTLRASAAHQPGILSDIGIGTFVDPRQQGGKLNDVTKEDLIKLVEIDNKEYLYYKAIAPNVAFIRATT… |
| A0A7J7ATJ3 | 286-413 | FERQYLNGELEVELTPQGTLAEKLRAGGAGIPAFFTQTGVGTLVAEGKEVRNFAGKDYILEHALIADIALIKAYKADKAGNLIFRKT… |
| A0A7C2VVM9 | 73-250 | None |
| A0A356ZZW5 | 4-130 | None |
| A0A6G3VAQ0 | 15-117 | None |
| D9UQS8 | 31-197 | None |
| A0A2H5F3E5 | 191-320 | None |
| A0A5N4DC68 | 169-330 | None |
| A0A5N4DAS8 | 307-450 | None |
| A0A1A5ZTA3 | 111-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.