DPCstruct | MC23508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 164 ± 19 aa |
| Standard deviation of domain lengths | 19.11 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 20.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09712 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A7LBP3 | 7-177 | ENDELGKSMLGIWEEIFKLPTIGPLFSYFGNIKDKNAQVANLAETIMKSQITLGQYWKQVNQAYVNAALRINEKTSSSLLDIKTKKD… |
| A0A0T5ZD79 | 7-162 | ALTSVGPMRNFSTNAKKIATELLDASEDLAEFNKRLTEYYQQLADTWANAQKKVNAKIPKIPNDQEQFDSYKRIWIDMFDNDFTELF… |
| A0A136ND90 | 97-243 | None |
| A0A2N6CZC4 | 99-292 | None |
| A0A1Z8R8H8 | 23-213 | None |
| A0A7J3M271 | 80-279 | None |
| A0A450YFN9 | 201-341 | None |
| A0A348W342 | 2-143 | None |
| A0A2M7YD21 | 3-144 | None |
| A0A6S6SC50 | 160-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.