DPCstruct | MC23507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 246 ± 20 aa |
| Standard deviation of domain lengths | 20.38 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0Y345 | 13-248 | TWPDVSAMEVNADELAQLILKKGRPVHLNQLVPVAVEAWLETLSRERRYMPGDSYSAGEIIRFNGQPAKVEAVQIDGNPKQGRFQIL… |
| A0A3D0CU15 | 5-252 | TQTERYWRDKFRLTDEDRDNLLESFITKATPLSTDAIARFLMNERYRAEERVLAARVPANAYQPAGHYQVGDHLVFAALGGGRGEVV… |
| A0A7V5YWN3 | 1-274 | None |
| A0A2M7JQI5 | 13-263 | None |
| A0A3A0GCB6 | 1-226 | None |
| A0A3M0Y3Q6 | 4-269 | None |
| A0A1W9V3J9 | 4-191 | None |
| A0A497JEQ9 | 6-253 | None |
| A0A7Z9XMP0 | 6-257 | None |
| A0A1F8RNY7 | 65-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.