DPCstruct | MC23505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 112 ± 21 aa |
| Standard deviation of domain lengths | 21.10 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 91.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16798 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7LJC5 | 1-114 | MNLTKNFPRSPYEKVGGYMMLGRTIDKAHATLQSLLGEYMYDCPLDKRLFDFLGISAGQLLKLAENSESDEGVVESLKTIQVERNTE… |
| A0A3C1JTM6 | 1-98 | MDLRTRRPRSPYETVGGIRFLPRTIDKMRAHVSGTAGDYRVHVGASRRIFRLFGISSGTFEEIVKANQTDEEILAALMALKNLTPAD… |
| A0A3L7YG17 | 44-139 | None |
| B9XDX7 | 43-127 | None |
| A0A7W1BKN4 | 1-120 | None |
| A0A2V6I3B6 | 8-91 | None |
| A0A532EDW0 | 72-219 | None |
| A0A4Q2XWD9 | 95-240 | None |
| A0A6J4K650 | 27-99 | None |
| A0A5E6MAU4 | 125-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.