DPCstruct | MC23500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 232 ± 18 aa |
| Standard deviation of domain lengths | 18.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0505 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9BIN1 | 1-201 | MIFNKVFYEDKKIENERLELTDKGSLYFLGPKLTLSHCTLVLKVPARSLFIEGVRFVDCTFEVKQELKNHQQWVYASLKGCRFKGSL… |
| A0A3C0XGJ6 | 121-359 | ELDASSGVVHIRRATIEDVDFRKVAFSRFTPEACIFVNCDFRGLVFDRKWQPLFSSPVQSVFRDCRFDDADLSRADPGQTRFEGCTF… |
| A0A268SNN9 | 8-249 | None |
| A0A1C3X9U5 | 28-280 | None |
| A0A1H9WLT5 | 151-383 | None |
| A0A7Z0IP81 | 21-278 | None |
| A0A3M8A8D2 | 94-314 | None |
| U2RLF7 | 10-239 | None |
| A0A6I1FW94 | 9-218 | None |
| A0A522AWG7 | 71-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.