DPCstruct | MC23498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 325 |
|---|---|
| Mean domain length (aa) | 188 ± 27 aa |
| Standard deviation of domain lengths | 26.56 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.18 |
| Pfam Score | 69.57 |
| Assigned Pfam label(s) | CL0023- CL0113- CL0123- CL0061- PF16861 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2VD64 | 11-176 | NPDPLILDKAAKILRSGGIVAFPTETVYGLGGVVYNEDAVKKIFWAKKRPIDNPLIVHVSSLSMLEEVAVSIPEKAYLLIERFWPGP… |
| A0A2N3GXL9 | 11-200 | NPSAEAINLAATVLREGGIVVFPTETVYGIGASANSCIGPQEIIDIKMRPKNKPLPWLVESEEALDTYGVDVPDYAHRLARAFWPGA… |
| A0A7C5Z468 | 133-335 | None |
| X6J8X3 | 2-140 | None |
| A0A803PWQ1 | 451-648 | None |
| A0A1F3W7V9 | 136-340 | None |
| A0A1Y2H3T5 | 112-310 | None |
| A0A0K9R128 | 319-522 | None |
| A0A518HJL2 | 444-644 | None |
| A0A7E4W4V7 | 15-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.