DPCstruct | MC23494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 216 ± 18 aa |
| Standard deviation of domain lengths | 18.45 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4VBW8 | 2-185 | GMRLRRVVPSRVINPLIKATKAGINVSINKLEAHYLAGGNVDRVVNALIAAQRANIPLEFERAAAIDLAGRNVLEAVQMSVNPRVIE… |
| A0A2E9G4W0 | 4-228 | VTILIFWFLGLITFFIFLFFVPVNLWLTALSAGVYVSLFKIIKMRTARVPPRIIVDSLINARKSGIKLSDDRLSEHYLAGGHVPHVV… |
| A0A660VYF4 | 1-233 | None |
| A0A7X9TCB5 | 2-193 | None |
| A0A7C6QQ74 | 14-228 | None |
| B5JKW3 | 1-191 | None |
| A0A2C6MA73 | 2-219 | None |
| A0A5C6BYK6 | 15-255 | None |
| A0A1W9MNQ1 | 1-229 | None |
| A0A419EV84 | 165-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.