DPCstruct | MC23492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 5.96 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9UHT1 | 1-71 | MSNEADEAYSVTEQLTMTGINLIRQKINAHGIPVYLCEACENPIPEARRKIFPGVTLCVECQAYQERQRKH |
| E3BKQ2 | 1-75 | MANGFTKDGGVQEQIDATIDDAIVRARSKLHHQSNTTEYCIECGEQIPLGRRQALPGVELCIQCQSEKDDNEKAL |
| A0A3C1F554 | 3-65 | None |
| A0A1X7LNS3 | 1-71 | None |
| A0A1X7M0S9 | 1-68 | None |
| A0A0A8R9Y5 | 80-147 | None |
| B0TKU6 | 1-67 | None |
| A0A4U9HC94 | 4-75 | None |
| A0A519PRW8 | 36-104 | None |
| A0A2P5N6U8 | 7-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.