DPCstruct | MC23491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 246 ± 39 aa |
| Standard deviation of domain lengths | 39.08 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.27 |
| Pfam Score | 98.81 |
| Assigned Pfam label(s) | CL0070- PF00351- PF12549 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E2UFJ3 | 10-237 | KQIYENYTEEDFKVWELLFNQQIDNLKDVVAIEFLDSLKVVGFKPETIPKFDELNKKLYNLTGWKITTVPNIANSKEFFYNLSKKRF… |
| E3BHJ0 | 2-207 | EIIKSNIDIIDSCVVNNMKELGYFNSDFSFYDFNNVLKKLKIEIGFTVPQKADSWFLMLSGGFFPHYQHIRNRSAINHSDKPDFFHD… |
| A0A6P4E647 | 40-308 | None |
| A0A3P7DVQ9 | 26-230 | None |
| A0A3M8FZ50 | 21-270 | None |
| S7J6W4 | 2-243 | None |
| A0A7T9DFV9 | 21-296 | None |
| A0A4Y2LQ77 | 95-246 | None |
| A0A820ZBR3 | 129-405 | None |
| A0A1D2N4Q6 | 630-915 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.