DPCstruct | MC23490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 102 ± 10 aa |
| Standard deviation of domain lengths | 9.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K8A435 | 113-211 | KTARKRRNRFMRMLWSWCKKNRHDPIGEQHETLCSKLRGFYQYFGVRSNFKVLEVVYEYAQRAWRRWLGRRHRDGYISHKKFDNILA… |
| A0A348FXY1 | 2-111 | KHKTQSTRLTRKLAAIRQENAASHASPPLALQHRWLASVLRGHYGYFGVPHNWRALNAFRRDIRRIWFKSLRRRSKKNRRMGWDWFE… |
| A0A0E1CGD1 | 6-112 | None |
| A0A4R1WY20 | 266-367 | None |
| A0A4V6QAA0 | 175-282 | None |
| A0A7R7CQX4 | 41-135 | None |
| A0A838P968 | 1-87 | None |
| A0A1G0HK17 | 108-205 | None |
| A0A8B1MNC8 | 129-242 | None |
| A0A7C2AYA7 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.