DPCstruct | MC2349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 204 ± 24 aa |
| Standard deviation of domain lengths | 24.00 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 66.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6ZPB5 | 1-172 | MKLLDFLFLQMTVLLANCSEYKKTIKRDLNLGLADSGFFGHQEPIHTVAVTKKVPYPVPYPVPYTITKPYLVKVPIKVPYEVPKPYA… |
| A0A7J7ALN2 | 1-200 | MNSLSVIFLLLGTVFTEEVAKLRKTQKRGLLEDEHSYGSSGNGDDFGQGGFQENNNHVTVTNQVPYPVPHPIPVPVEKTIPYPVHIP… |
| A0A7M7GBH3 | 4-164 | None |
| D2A0F8 | 1-213 | None |
| D2A0G6 | 2-220 | None |
| A0A2P8Z5I4 | 1-184 | None |
| U4U7B7 | 1-218 | None |
| A0A2P8ZAC1 | 1-191 | None |
| A0A6A4JZP9 | 2-226 | None |
| A0A6V7HG88 | 2-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.