DPCstruct | MC23488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 209 |
|---|---|
| Mean domain length (aa) | 284 ± 78 aa |
| Standard deviation of domain lengths | 77.80 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 74.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 21.76 |
| Pfam Score | 99.70 |
| Assigned Pfam label(s) | PF20235- PF03140 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A314YDS7 | 5-152 | HTNFRGYFEPTVIAIGPIHHGKARYEWGEELKLRLAVNFVRDSEQNEARLLKKVDEYIKELRECYDKEAIKNYDNDSLALMLFVDGC… |
| Q6YPE2 | 14-330 | IQERVTFERLEADFCKNERKIHRFPQGLRRWIGGEGDRYIVPTFVALGPYHHGEPHLQKTEELKYATAHYLCMKWGRSVEEVYGKVL… |
| A0A6V7PA21 | 1-220 | None |
| A0A0D9XSS1 | 369-861 | None |
| T1NPK2 | 217-476 | None |
| A0A811MYP9 | 2-277 | None |
| A0A453DLZ8 | 13-264 | None |
| A0A6A6LH30 | 2-256 | None |
| A0A6J5VDJ0 | 123-334 | None |
| A0A5E4EES3 | 19-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.