DPCstruct | MC23486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 439 |
|---|---|
| Mean domain length (aa) | 136 ± 31 aa |
| Standard deviation of domain lengths | 30.61 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 83.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 13.00 |
| Pfam Score | 61.48 |
| Assigned Pfam label(s) | CL0010- CL0248- PF20233 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J9QRB5 | 27-172 | QTVAREQWPDFFSAGKIFRIKISDGTLRVYVIVEPGERSSTCLMIKTYSGQATTRPDVRDRQNEHAVIYTMAQPPKPLRGEDKLRRP… |
| A0A0B5B089 | 26-163 | KYAKKEKSMMEFPKRGDIWTLDFGQGVGSEMRGTRPVVVLSSSLTNEKTNTLLVLPITKHSGTEESERNTDFIFHLPLTPDLLKWGG… |
| K2S9K4 | 185-336 | None |
| A0A2V4WHN3 | 2-119 | None |
| A0A087Q9T8 | 9-134 | None |
| A0A6M1LGE7 | 2-116 | None |
| A0A7G6T632 | 6-114 | None |
| A0A538Q208 | 29-150 | None |
| A0A412J2H0 | 61-180 | None |
| A0A395WC71 | 41-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.