DPCstruct | MC23482
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 133 ± 11 aa |
| Standard deviation of domain lengths | 11.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10720 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0FPW1 | 2-118 | YSLIINEQNLIQEPIISKLFYQKKVFQTVPFYLQELFHFNAVIFPTCYGEIFGATVKKFVKLDQRIELGKKLAWILFDMGRLQTFID… |
| A0A0B5ALS8 | 13-141 | MVPVWQSFLKQQNSELLTIALIINEQQYIEGRLISNACYRTHVYESSTFKYQEFFHLNHVIFPYAMEKRVKVIGLNVSHFAPLEQRI… |
| A0A516KHP8 | 189-323 | None |
| W4QTU3 | 173-321 | None |
| G9QII7 | 3-140 | None |
| A0A268E4W6 | 102-239 | None |
| A0A5J4J792 | 16-152 | None |
| A0A653UXK5 | 148-282 | None |
| A0A3T0KR51 | 55-192 | None |
| A0A3G3JT42 | 334-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.