DPCstruct | MC23473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 468 ± 69 aa |
| Standard deviation of domain lengths | 69.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A086F467 | 102-594 | SWFSDFINESVETELLAFNYRDILGWTEKGYVQPSPRLLGHHLSNYPSELEKHPETLQTHFWYLCEYPSRSLPFYKEWLPLIQKLVR… |
| A0A3N6EWQ7 | 79-502 | LPDAEGLGRGLAHNVTTREGTGIAALALLARDGHVDRSRLLRAALQGPLRSEPRTVTPGYLALLTALDPTLDEQTAAADTLVGLVGS… |
| A0A7W5V9Y5 | 5-619 | None |
| A0A4V2YRU1 | 101-610 | None |
| A0A0X8JCS1 | 18-468 | None |
| A0A2Z5QXY1 | 22-400 | None |
| A0A3P1WVP2 | 30-508 | None |
| A0A3P1T710 | 60-511 | None |
| A0A496PHN9 | 11-594 | None |
| A0A850JEA8 | 146-546 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.