DPCstruct | MC23472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 3.78 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 30.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11042 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A233I4K4 | 1-68 | MPFWSTKEDAQTHNVEEWSDFEVLEIPLDIFVEDWLITLDEDGVLIGTNWNASLEGKEVEPADLAKMY |
| A0A413WQT6 | 100-168 | LLFFSSRELALACRVKEWADYHVIELPVELFLERWLPNMSDDELLCGLDWSSELVGFEYDPETILEYFE |
| A0A4R4DT51 | 53-124 | None |
| X8F7E0 | 11-80 | None |
| A0A1Y6FY37 | 48-117 | None |
| B1YF89 | 1-76 | None |
| A0A3A8EW21 | 1-76 | None |
| A0A268II48 | 171-249 | None |
| A0A2U2P954 | 24-96 | None |
| A0A1V3XRT3 | 11-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.