DPCstruct | MC2347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 6.65 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 78.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377D7V4 | 103-185 | AQGNQLFMNDVFLKRLFAVSITSSGNPPTFSLTPEGRLTARNADISGHISANSGTLNNVVIAENCTIKGTLRAENIIGDVVKT |
| A0A4S5HXC9 | 1-85 | GQGDQIFMNEVFLKRLTAPTITSGGNPPAFSLTSDGRLTAKNVDISGSVNANSGTLNNVTINQNCTIKGMLEATQVRGDFVKAVS |
| A0A3P6KK55 | 57-138 | None |
| A0A376ZH65 | 15-99 | None |
| A0A376SNI5 | 57-141 | None |
| A0A787A8W6 | 1-75 | None |
| A0A2Y0PM46 | 2-64 | None |
| A0A376LP07 | 3-86 | None |
| A0A376LMQ5 | 374-458 | None |
| A0A4P0Y9E9 | 45-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.