DPCstruct | MC23461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 168 ± 23 aa |
| Standard deviation of domain lengths | 23.13 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7BNE6 | 3-177 | DLAGLESVFKTYGVSTIKVESNGNLTLPVTESLSFSLRPNIESSPAWEGMSLGLHTQPTTLPGVLTFMLVFKDENGSLRQQNLYPAA… |
| A7BLP1 | 20-195 | IENPAALQTALIEWGLVRFEMGSDGNLSISGDPQFKIRPDLFSRITDASLALGLDWKTSPLLSGLNQLVFRFQDKTGAHREQVFYPV… |
| A0A2A5B161 | 586-749 | None |
| A0A251X3U1 | 440-607 | None |
| A0A496V5P6 | 305-439 | None |
| A0A0Q8TDD3 | 132-293 | None |
| A0A1F4CX03 | 244-403 | None |
| A7BVI4 | 139-316 | None |
| A0A3C0P7U4 | 422-596 | None |
| A7BST5 | 181-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.