DPCstruct | MC2346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 151 ± 23 aa |
| Standard deviation of domain lengths | 23.22 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0GU60 | 71-207 | GSKVIKSNDDLNIEQYNGVNKIGKPSGHGYAFEDINNRNIRKTGCKVDSSIGKTCEKGGADAVVTDKDGNSFEVQYKCTSSAKLAAD… |
| A0A4Q6H9R3 | 2-148 | KLPETWSTNEKMFASGGQGHGFAAERGNHIVDRVRLKNARILGDNNARNGADRLVSGTEIQTKYCSTAARSVGAAFDGQNGQYRYMG… |
| N1ZGI7 | 402-525 | None |
| A0A521F0N3 | 3-166 | None |
| A0A125PCS0 | 26-162 | None |
| A0A1H6P2Q5 | 22-206 | None |
| A0A8B3DN79 | 390-572 | None |
| A0A376VJJ4 | 125-272 | None |
| A0A231PVK5 | 298-442 | None |
| A0A482IMM6 | 13-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.