DPCstruct | MC23458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 141 ± 15 aa |
| Standard deviation of domain lengths | 15.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0053 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P9DS66 | 13-152 | FPESLKNKFLVFYLILSLYLPYIQATGRLEAALRDLQKIEVSSEIDAYLYTADLNYSSHCNLSVLKCFQLEMEVVSYESKYGDRKFH… |
| A0A3B3RCZ5 | 1-127 | MGFPRQRSMLRQVQLEFKNVNKSLMHNELMLHTPHTDEIENCCSTSALKCFVKSLPQLRVPNSAAKVKATLIKNLQKKIIENSVRTC… |
| A0A5C6ML66 | 97-242 | None |
| A0A6P8QGG6 | 45-187 | None |
| A0A3B3YZW8 | 6-142 | None |
| A0A498NEE3 | 22-139 | None |
| A0A6P8G115 | 53-219 | None |
| A0A2Y9G7V8 | 12-134 | None |
| A0A835NR40 | 44-173 | None |
| A0A553QIU6 | 41-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.