DPCstruct | MC23456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 113 ± 10 aa |
| Standard deviation of domain lengths | 10.12 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E9M2D9 | 122-245 | VPFYQVPGNKEMADDYAIVISTSHHEPMMTNSHEYDVSVLGPYNYWTNRETIYKFWEDRVRETASYENIYTIGMRGRDDSGMAAPAG… |
| A0A1W1UUY0 | 1-120 | MFNVNDPQNPVLADEYGIVMGTSHHEPLTRAHEKWKHAGKGPWNYQTNTAALQEFWRGGMKRMGTRENIVTVGMRGDGDKPMSEGSN… |
| A0A3D1D251 | 432-556 | None |
| A0A090WUM6 | 61-167 | None |
| A0A1G8MBE7 | 169-281 | None |
| T2F5N3 | 47-159 | None |
| A0A6V8H7C7 | 86-185 | None |
| E4ZZY4 | 36-149 | None |
| A0A0E9LVS6 | 111-234 | None |
| A0A0W0GEG8 | 42-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.