DPCstruct | MC23451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 99 ± 4 aa |
| Standard deviation of domain lengths | 3.85 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 69.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 47.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0375 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3N5X8 | 1-97 | MKTTRKCRALLSVGLNLVALFFSTTAFITTYWCEGTQRVPKPNCSKQRRHNCIDNSTNETDKSKVHYSWETGDDRFLFRRFHTGIWY… |
| A0A6A5E920 | 1-103 | MAFLQQMRSPRLSFIQTVVSLITGGVALMSSYWCVGKQKVPKPLCSPIKQSKCIPVPGVTNSSTIHFSWETGDDRFVFPSFHTGLFL… |
| A0A0F8AML5 | 93-195 | None |
| A0A1L8ENC5 | 75-175 | None |
| A0A7J5YX74 | 35-133 | None |
| A0A4W5PKX2 | 18-119 | None |
| A0A4Z2G4P9 | 1-103 | None |
| A0A553Q1G9 | 39-131 | None |
| A0A6G0JCJ2 | 1-97 | None |
| A0A6G0JCB9 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.