DPCstruct | MC23450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 5.99 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C4A0D4 | 2-79 | QPKSMTRAKKWDEVVENAYRFQLAGYRDEEEYRSVKQVDSAEKWDNGFVKKLQRKDGCFYYYNKARECSDKDVPKTKL |
| A0A6A5E808 | 9-87 | KPKSMSRAKGWTAEVENLFRFQEAGYRDEMEYIQVKQGILIDKWPESGFVKKLQRRDNTFYYYSRKRECEDRDLYKLEL |
| A0A177B5W9 | 1-77 | None |
| A0A7T1L7A1 | 51-130 | None |
| A0A7M4DV16 | 238-320 | None |
| R1FD56 | 404-490 | None |
| A0A7J6AAJ3 | 12-92 | None |
| A0A815LLB1 | 3-71 | None |
| T1JE87 | 168-247 | None |
| A0A7S0JQR7 | 165-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.