DPCstruct | MC2345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 177 ± 17 aa |
| Standard deviation of domain lengths | 17.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 16.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A543GBG7 | 5-181 | ATPTTVRALDLPSAGKLAGLAAVFEDLQYALRCCEHLVSRLGRREPDPVLVEALWTGALLAYVRCFSPRSALLTTTDLDELEDGAEF… |
| A0A4Q6H1Y4 | 3-165 | LPRIPLKGRFVEQYVALQLLDKDLRNVIGWENIIKNICNNINREQHFIYPDLEKNLILKSLFISKVVTYGKCFTEAKGRRFTLQRKH… |
| A0A7W6KBC2 | 19-195 | None |
| A0A7M3DW74 | 11-185 | None |
| A0A1Y5RG97 | 8-176 | None |
| A0A6N7XK08 | 14-203 | None |
| A0A1W9H5M7 | 5-148 | None |
| A0A6G7XG72 | 15-195 | None |
| A0A2W1K3T3 | 43-239 | None |
| A0A558JEM4 | 1-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.