DPCstruct | MC23449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 102 ± 8 aa |
| Standard deviation of domain lengths | 7.79 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 57.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K8R3T0 | 1-87 | MSMCSGLHLFCSIDNGTGFAFPEQLIALWAQEGTQNGKEVLQSLDFSVDEKVNLSELTWALENELMMIRGATQQVALPCYRQELRFC |
| A0A6A5E6I8 | 1-107 | MQCQAVLEERLVRSTSPSLLTATVGQRVLSRLDDGSGCTSPERVITLWTEEGIRNSQEILQTLDFPLEERVSLADLTLALDNEMLVS… |
| A4IIE1 | 284-390 | None |
| D3ZIT3 | 48-150 | None |
| A0A402FRX5 | 114-216 | None |
| A0A4W5KNH8 | 1-88 | None |
| A0A2K5E551 | 48-150 | None |
| A0A4Z2C588 | 1-107 | None |
| A0A060YHF6 | 48-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.