DPCstruct | MC23448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 138 ± 26 aa |
| Standard deviation of domain lengths | 26.49 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.49 |
| Pfam Score | 96.31 |
| Assigned Pfam label(s) | PF16180- CL0073 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444TPA1 | 274-373 | VQITEQPRPKALRFRYICEGRSAGSIPGVHSTPTRKTFPTIRVVNSKGPALVVVSCVTVTEPYKPHPHNLVGKEGCEDGICSVLIDN… |
| A0A6A5E481 | 28-153 | DYIPPVDIKTEPYIPETAHGPYIQIIEEPKQRGFRFRYECEGPSHGGLPGASSEKNRRTYPTVKINNYVGHARVEVQLVTHSDPPRV… |
| B5M234 | 95-298 | None |
| G3HPD2 | 604-750 | None |
| G3HXW0 | 18-132 | None |
| T1EH78 | 2-104 | None |
| A0A1A9VU23 | 2-110 | None |
| A0A1A9ZVF8 | 3-107 | None |
| A0A1I8IVL2 | 2-140 | None |
| A0A2K5NFI2 | 66-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.