DPCstruct | MC23447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 138 ± 18 aa |
| Standard deviation of domain lengths | 17.60 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L2PUI3 | 1-121 | MEKEQESCRAAEEELAVAEYELSEVEAQLLHLNDRKQLLLERIGRQKDAILLKKNHLLTSRDWSNFPWSNKVKEVLNSVFKLNGFRP… |
| A0A6A5E3M7 | 1-180 | MDGGGRNKDVQAELDSVEAELELVELQIAELLQKQAELTSRKDALLQRLEEACDAAQPSSSSSSSSSKSSGAHPAMSKQEMQLYDGT… |
| A0A3P6ST00 | 1-148 | None |
| A0A5S6PNK3 | 5-125 | None |
| A0A388L118 | 27-185 | None |
| A0A7J6D5Y8 | 2-139 | None |
| A0A7J0FQC2 | 4-117 | None |
| A0A5D6XWC1 | 2-123 | None |
| A0A0N5DBD5 | 22-163 | None |
| A0A137QB35 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.