DPCstruct | MC23445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 111 ± 12 aa |
| Standard deviation of domain lengths | 12.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.50 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0486- CL0077 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8X7N6 | 267-364 | ADTTTPEEEEHPRLVQPSHLVPYDPTQEPIFPPELKLNPKYETENLVFKGSRVTWYRPASLDEMLRLKATHPEARIIHGNTEVALEI… |
| A0A6I8NZR2 | 171-278 | KDEKTLTPPIPLLWQVTLSPSLFNPGEFLPLDPTQEPIFPPELVPVETPSQPPQLRFQGERVTWIQAATLEELLDLKSQHPDAVLVV… |
| A0A498MG36 | 80-199 | None |
| A0A2N9GHH9 | 123-246 | None |
| A0A821VLJ1 | 120-243 | None |
| A0A816FL08 | 1-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.