DPCstruct | MC23442
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 273 ± 21 aa |
| Standard deviation of domain lengths | 21.34 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W0ACG5 | 340-583 | TADLRNHVRFMADYPILSDEWKEMAKNMTRFGEISEMERKLPKQENATLWECEELALRYILEDGKLNLCLRILVEYKEYERNTAIRD… |
| A0A835YQR7 | 2-251 | AQTLGRVASITEMESKLPRASSRQTLWEGEEQALRYVIEDGKLNICLRNLVDFKAYEMKLRSDDVEPEQRQKDLMDKFEKGMGCMLR… |
| A0A024G7Y5 | 26-274 | None |
| A0A7S3RBI2 | 3-284 | None |
| E1F2A3 | 29-299 | None |
| A0A0W8BZA8 | 55-326 | None |
| A0A0G4GJC2 | 20-325 | None |
| A0A1Q9C4M1 | 24-338 | None |
| A2EYF5 | 22-298 | None |
| A0A6A5BL93 | 200-462 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.