DPCstruct | MC23440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 351 ± 42 aa |
| Standard deviation of domain lengths | 42.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2KPV2 | 429-781 | VLSRTLSMGHKIQKLSYNSTSDSVDVVQYYANFAENESPQSYRYLLWSALRQDYVSVVQTFTKYTSPYKWNELDMLLSGDTISSISE… |
| A0A835YMX3 | 1-315 | MGHRIHSLSYDEQTKQVEVKRFMSRYGSNTVPGNCYSYRYSLWQALDGRFQTVKQMFYKYPSPEYSWNYLDELVCGYNSDLIENTKY… |
| A0A7S1DA88 | 18-377 | None |
| A0A0M9FQY7 | 514-917 | None |
| M4BL07 | 264-605 | None |
| A0A6G0WPY6 | 717-1112 | None |
| A0A067BXU5 | 1-374 | None |
| A0A7S4V9S6 | 1-278 | None |
| A0A3R7KVW8 | 32-393 | None |
| A0A3R7K8E5 | 34-388 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.