DPCstruct | MC2344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 160 ± 32 aa |
| Standard deviation of domain lengths | 31.53 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.22 |
| Pfam Score | 84.98 |
| Assigned Pfam label(s) | CL0123- PF07663- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377E3P5 | 2-134 | KLNYVVSFSLQHVRVIPGLADADVGGRLGIGAAHMLMSLLQPQQMLAIGFGEATMNTLQRLSGFISSQQIRLVTLSGGVGSYMTGIG… |
| A0A4D3QVJ9 | 1-159 | MENSDDIRLIVKIAQLYYEQDMTQAQIARELGIYRTTISRLLKRGRDQGIVTIAINYDYNENLWLEQQLKQKFGLKDVVVVSGNDED… |
| A0A809SKR2 | 8-150 | None |
| T2REJ3 | 12-193 | None |
| A0A0K2RB68 | 1-126 | None |
| A0A163LA63 | 16-187 | None |
| A0A1F8L8V5 | 8-162 | None |
| A0A6N6XD94 | 2-150 | None |
| A0A7W1S8H2 | 90-295 | None |
| A0A840USY6 | 9-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.