DPCstruct | MC23434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 376 ± 30 aa |
| Standard deviation of domain lengths | 29.64 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420YHX6 | 233-612 | GPALNTLYLGISAVFADDHTAVVALAIHDTVYLIDFSVKHIVLDDALKLGDDLIADYIINEVEKYEHENFAKFIGAGLPTTLKYMSP… |
| A0A397G5G9 | 29-411 | NTIWAGFSELIEEGSKTRIAIVIRNSTYLLDCVIHEWEERASRDPAEISHEIISQLQNYSAKYMEKFIGAGLPESLVLKCPGLCSQL… |
| A0A1Y2IB02 | 37-452 | None |
| A0A178F3H5 | 32-406 | None |
| W9NWI3 | 37-412 | None |
| A0A094KNQ6 | 44-437 | None |
| A0A1J8QPR2 | 36-453 | None |
| A0A421DHL9 | 556-964 | None |
| A0A428TPC6 | 34-335 | None |
| A0A093VDU6 | 31-417 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.