DPCstruct | MC23430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 184 ± 12 aa |
| Standard deviation of domain lengths | 12.15 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G7M0E5 | 1-180 | MSVPRTLRMAAEDFAALAGCHPTAPALAVLRDGQVSRRLLMLKGVADTARRKVPALWEETGAAEGWELCTRARVTDVAAYERVLLHP… |
| A0A8A3HNJ3 | 1-190 | MTVERLPPGALARLARTRSAPGDHAALRDGAHSLRLVLLKSLLTRLERHPGAVPRPARERFEEHWRLLERTEARDRRPVRDTLDYPS… |
| A0A495QL66 | 416-619 | None |
| A0A4Q6IIJ2 | 1-177 | None |
| A0A4R2DWA5 | 180-369 | None |
| A0A4Y8MDZ7 | 132-317 | None |
| A0A5D0NM58 | 58-237 | None |
| B5GKL1 | 397-585 | None |
| A0A6I5DXE4 | 1-193 | None |
| A0A6V8L8N8 | 134-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.