DPCstruct | MC2343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 97 ± 13 aa |
| Standard deviation of domain lengths | 12.97 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0U6J4 | 2-70 | KVIENTGETALVHSHCPRCQGAVLSLLYTDFLGVTMMAVITDMNYDDTIRIKDSGMVKEDDVLEVYKKI |
| A0A3D0V516 | 14-111 | ERLQILSFCPICETKQHSMQAKILEIEGNHCLVHMTCRKCHNAILALVQTNASGVSSVGMMTDLSFEDVVKFQSGSQITLDDVISSH… |
| A0A6F9ZZZ3 | 2-95 | None |
| A0A7V4PDV1 | 4-97 | None |
| A0A1F7UYU8 | 1-79 | None |
| A0A0G1XQ28 | 6-116 | None |
| A0A0G0MKG0 | 2-80 | None |
| A0A3D2NR70 | 22-112 | None |
| A0A1F5PGF5 | 8-108 | None |
| A0A399Z2E6 | 16-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.