DPCstruct | MC23428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 90 ± 12 aa |
| Standard deviation of domain lengths | 12.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4YLM3 | 251-356 | AQIDPVQHPDIPSEVDNYHTLYPLEPVPRDPKHRSSTFGFITSCYKSISAKDAMAYCLTRIHGFHMVNSKCMLFTDMWKKIQHSNIV… |
| A0A3P7P0S8 | 1-102 | MRAGAKFPTTLGAYDTVTPIEASSNPRVSDALGFPTQCFRAWSPRLASPVLLRRVILPKTAPPLPNEAYYLAKQICDLEHPSVVHLR… |
| A0A821B0M7 | 127-193 | None |
| A0A821UWC1 | 68-162 | None |
| H0EKB1 | 95-164 | None |
| A0A4V5NBB9 | 319-430 | None |
| A0A1V9WYG3 | 1-86 | None |
| A0A2Y9NLS3 | 493-586 | None |
| A0A183HM26 | 104-189 | None |
| A0A7J7K3L1 | 562-653 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.