DPCstruct | MC23427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 84 ± 6 aa |
| Standard deviation of domain lengths | 5.74 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 50.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077ZFP5 | 219-302 | MPTTLDMIAGKKSLQPDWSSTWKAEPCKCAPADYGGMIAYYEPGRYPDRFVAMNEQNAKRCVETIYDNPSMYSMTAETSLCLTV |
| A0A3P7LP81 | 1-84 | MPVKLDALRYNYSYQPDWSSTWREEPCNCAPAGYGGLIPYFDPAYYPQEFVQLNEQNRLRCVASVYANPSMYSLNNATSPCLNH |
| F1KQN6 | 144-227 | None |
| A0A2G9V5S5 | 305-382 | None |
| A0A4U5NEL2 | 356-437 | None |
| A0A2A2K1S7 | 456-539 | None |
| A0A2A6CSH8 | 442-532 | None |
| A0A3P6RND7 | 95-178 | None |
| A0A0V1F060 | 370-438 | None |
| A0A1I8CHA3 | 648-743 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.