DPCstruct | MC23423
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 90 ± 6 aa |
| Standard deviation of domain lengths | 6.48 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7VTW6 | 11-95 | LVLLLLILSSSYCLEWDVSNFPNPTAGDYKRCRMRTTSNICDPDEVLTDSQRYRLNHELHQLESRTRQDHASDFCQKKGITAAMA |
| A0A3P7KQ86 | 1-92 | MLLILLSLAALSAQQQWSPEDYPNPRKGGYKQCNMRSSSNVCDPDEVLSESSRYRLNNELTNLARRTEAEGNTYCTRKGMDAVLAIT… |
| A0A6V7VBE0 | 1-97 | None |
| A0A2A2KP48 | 1-82 | None |
| A0A6V7VB69 | 6-98 | None |
| A0A183CG36 | 1-100 | None |
| H3FJQ1 | 193-284 | None |
| A0A2A2LZ12 | 165-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.