DPCstruct | MC23422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 115 ± 17 aa |
| Standard deviation of domain lengths | 17.21 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B2VIF4 | 2-107 | ASMSPTFLDWVSNTYGHMISDRLIRADLGPGGSFGGGGHIPLQRTQHQPVIIVHGITNRADRFWAIREHFISNGYSEAEVYATTYGD… |
| A0A3P7KNU5 | 11-121 | LFGWVHADFSPSFNEFLRNTYGEAFATRMARRDIGPHGSYGGGDHRMGSRTSRQAVVLVHGITNTAGRFEATRQHLLKKGWKESEVY… |
| A0A2G5U585 | 7-122 | None |
| A0A4U5N350 | 50-190 | None |
| A0A183FIM9 | 5-131 | None |
| H3DS54 | 14-136 | None |
| A0A2G5U4P4 | 2-75 | None |
| A0A6V7WLW2 | 25-145 | None |
| Q19941 | 11-125 | None |
| A0A0N5CXE2 | 7-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.