DPCstruct | MC23420
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 157 ± 9 aa |
| Standard deviation of domain lengths | 9.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 25.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183HGH6 | 2-145 | AIRQLCYYDRIVTSMNSVQDYNLLKYLSAVCVSIHMLLCCRGRTHLNFPTEYHNAVQRYEQSVEIVESVRAGATQKNLSLLTVALEI… |
| A0A3P7K5P6 | 1-149 | MKTIRMGAEAFIYYDRIMLAINEKQDYVLMKYIPIFYMLLHAAVATHTRAKLKYPQLEQSASQRRRESEETLATLQSGLLARHSPSA… |
| D3BTX9 | 58-205 | None |
| J4HV49 | 453-610 | None |
| A0A7R8XMW4 | 219-373 | None |
| F6HCZ5 | 143-314 | None |
| A0A0B1PPI8 | 38-200 | None |
| A0A1I7W0X6 | 530-678 | None |
| A0A1R1X4J0 | 1-168 | None |
| A0A1B0D4Z9 | 35-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.