DPCstruct | MC2342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 94 ± 6 aa |
| Standard deviation of domain lengths | 5.95 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5PIJ3 | 7-101 | QNASQQACSICSQLADRETAFQKFGWEENNSYLPAAAEALTIVRDFKPYSSRKLQLRRCPECGTHYLYSSDYEYLVNGSEDEETLER… |
| A0A355FW94 | 9-97 | PKCDICQHIPSHAEVEILHTSERLPKEVDQLEIIGGNHADSTLGQLRKCPKCGTYYLWFHDHDSESGTGYGYTDEGIERILPDQALE… |
| A0A523TC86 | 244-330 | None |
| A0A366HIY0 | 2-96 | None |
| A0A1G3L3J3 | 3-103 | None |
| A0A7W0T1C2 | 1-98 | None |
| A0A7V9L4R9 | 20-126 | None |
| A0A1F2X9R5 | 2-89 | None |
| A0A6A0IPM5 | 13-107 | None |
| A0A847HI24 | 13-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.