DPCstruct | MC23417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 120 ± 12 aa |
| Standard deviation of domain lengths | 12.46 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833WG23 | 644-755 | DFTENNERLIEPWEKTEIFDRSIRTFRATIGPSGGKKGYQGITGQTSTGLAWYIEGQLVPELYLRRGLTYNFRIHGGNNPHSPNLYH… |
| E9IZC0 | 1-112 | IFYVTADLCRESWQKTEIIDRSIRTFKATIGPSGGKRGYQGITGKPSIGLAWYIEGALIPELFLRRGLTYSFRVHGGNNPHSAELYH… |
| A0A5B7DD43 | 1-136 | None |
| A0A2A3EUM4 | 433-544 | None |
| A0A132AFT0 | 466-595 | None |
| A0A4Y2TF53 | 308-416 | None |
| A0A182SRU7 | 145-280 | None |
| A0A7R9BTA1 | 458-571 | None |
| A0A7R9QA92 | 276-391 | None |
| W5J2P6 | 199-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.