DPCstruct | MC23416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 165 ± 26 aa |
| Standard deviation of domain lengths | 25.65 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 40.06 |
| Pfam Score | 84.62 |
| Assigned Pfam label(s) | PF00082- PF02877 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7JWA1 | 1-174 | MGDTQQVDQPLEPVVSNFPVDTFIYKAESQQPDFVKKHGKYADGCNVLIAILDTGVDPSLPCLERTSFGARKIVDCIDCSGAGDVDT… |
| A0A0S7I7S5 | 2-143 | TTAVEPKDGTITGLSGRTLKIPPAWVNPSGKFRIGVKNGYEFFPKALKERIQKERKEKMWDPAHRAALAEVCRKTEEFDLAHPTPSQ… |
| A0A4S4DEI9 | 1-156 | None |
| A0A182EKP3 | 2-175 | None |
| A0A3L6VQH8 | 5-216 | None |
| A0A3Q0KLT9 | 10-159 | None |
| A0A5K4F4K4 | 9-135 | None |
| A0A5B7CU04 | 16-255 | None |
| A0A815KT58 | 183-377 | None |
| A0A5E4QC44 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.